PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v1058050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 375aa    MW: 42315.9 Da    PI: 6.8955
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v1058050.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.92.3e-54181432128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                      +pGfrFhPtdeelv +yLk+kv++k+l++ + ik+vdiyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t++g+Wkatg+d++++s+
  Lj2g3v1058050.1  18 MPGFRFHPTDEELVGYYLKRKVQQKSLPV-DLIKQVDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSARPNRVTRAGFWKATGTDRPIYSS 110
                      79***************************.99***************9888999**************************************** PP

              NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +g+ +glkk+Lvfy+gra kg ktdW+mhe+rl
  Lj2g3v1058050.1 111 EGKCIGLKKSLVFYRGRAAKGMKTDWMMHEFRL 143
                      *******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-5714176IPR003441NAC domain
PROSITE profilePS5100556.14617176IPR003441NAC domain
PfamPF023651.5E-2619143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MELEVRSDME KIDDVMVMPG FRFHPTDEEL VGYYLKRKVQ QKSLPVDLIK QVDIYKYDPW  60
DLPKLASTGE KEWYFYCPRD RKYRNSARPN RVTRAGFWKA TGTDRPIYSS EGKCIGLKKS  120
LVFYRGRAAK GMKTDWMMHE FRLPCMPSDS AAPPKKLSDK SFSATDSWAI CRIFKKTNSL  180
SMVQKALSHP WISELPGGMV SDLLTQQGAN FNQFCSENIT TPSAIQFCGN TKQEQLHQIS  240
NANITNFSVS ASASASDIPA YKPIINSNTV TKSQQIPVSD GDLADNLMFY TLEPTGPTNP  300
DYIGFEEPSQ NYGGFSISLP QDMQPNITQV QLNQWESTVE RTIGFPFNLP SNEAWKSALA  360
SWDSPPCSTE MSTSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-5431791171Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0105710.0AP010571.1 Lotus japonicus genomic DNA, clone: LjT17J13, TM1835, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013450964.10.0NAC domain class transcription factor
SwissprotQ9ZVH04e-96FEZ_ARATH; Protein FEZ
TrEMBLA0A072U5H50.0A0A072U5H5_MEDTR; NAC domain class transcription factor
STRINGGLYMA13G05350.21e-175(Glycine max)
STRINGGLYMA19G02580.11e-175(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.12e-97NAC family protein